CAMKV Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAMKV

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGYAQESQREEAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 473

Purification: Affinity purified

• Artikelnummer: AVIARP58882_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58882_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79012
• Wirt: Rabbit
• Konjugat: Conjugated, HRP