CAMKV Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV

Key Reference: Ballif,B.A., (2004) Mol. Cell Proteomics 3 (11), 1093-1101

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CaM kinase-like vesicle-associated protein

Protein Size: 501

Purification: Affinity Purified

• Artikelnummer: AVIARP58602_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58602_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79012
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin