CAMKV Antibody - N-terminal region : Biotin

CAMKV Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58602_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV

Key Reference: Ballif,B.A., (2004) Mol. Cell Proteomics 3 (11), 1093-1101

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CaM kinase-like vesicle-associated protein

Protein Size: 501

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58602_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58602_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79012
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×