CAPNS1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAPNS1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calpain small subunit 1

Protein Size: 268

Purification: Affinity Purified

Subunit: 1

• Artikelnummer: AVIARP58434_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58434_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 826
• Wirt: Rabbit
• Konjugat: Conjugated, HRP