English
CAPS Antibody - N-terminal region : FITC
CAPS Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58435_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS
Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535
Molecular Weight: 21kDa
Peptide Sequence: Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Calcyphosin
Protein Size: 189
Purification: Affinity Purified
Description of Target: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS
Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535
Molecular Weight: 21kDa
Peptide Sequence: Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Calcyphosin
Protein Size: 189
Purification: Affinity Purified
| Artikelnummer | AVIARP58435_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58435_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Rabbit, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 828 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
