CAPZA3 Antibody - N-terminal region : Biotin

CAPZA3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58604_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3

Key Reference: Miyagawa,Y., (2002) Mol. Hum. Reprod. 8 (6), 531-539

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-actin-capping protein subunit alpha-3

Protein Size: 299

Purification: Affinity Purified

Subunit: alpha-3
Mehr Informationen
Artikelnummer AVIARP58604_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58604_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 93661
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×