Capzb Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Capzb

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-actin-capping protein subunit beta

Protein Size: 272

Purification: Affinity Purified

Subunit: beta

• Artikelnummer: AVIARP58436_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58436_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 298584
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin