Capzb Antibody - C-terminal region : FITC

Capzb Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58436_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Capzb

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-actin-capping protein subunit beta

Protein Size: 272

Purification: Affinity Purified

Subunit: beta
Mehr Informationen
Artikelnummer AVIARP58436_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58436_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 298584
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×