CASP1 Antibody - middle region : FITC

CASP1 Antibody - middle region : FITC
Artikelnummer
AVIARP58983_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP1

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-1

Protein Size: 383

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58983_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58983_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 834
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×