CASP10 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP10

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: HNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-10

Protein Size: 479

Purification: Affinity Purified

• Artikelnummer: AVIARP59000_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59000_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 843
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin