CASP3 Antibody - C-terminal region : FITC

CASP3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58987_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CASP3

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-3

Protein Size: 277

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58987_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58987_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting
Human Gene ID 836
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×