CASP4 Antibody - middle region : Biotin

CASP4 Antibody - middle region : Biotin
Artikelnummer
AVIARP58990_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP4

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-4

Protein Size: 377

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58990_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58990_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 837
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×