CASP5 Antibody - middle region : Biotin

CASP5 Antibody - middle region : Biotin
Artikelnummer
AVIARP58992_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP5

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-5

Protein Size: 376

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58992_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58992_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 838
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×