CASP6 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-6

Protein Size: 293

Purification: Affinity Purified

• Artikelnummer: AVIARP58994_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58994_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 839
• Wirt: Rabbit
• Konjugat: Conjugated, FITC