CASP7 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CASP7

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-7

Protein Size: 336

Purification: Affinity Purified

• Artikelnummer: AVIARP58995_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58995_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 840
• Wirt: Rabbit
• Konjugat: Conjugated, FITC