CASS4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CASS4 is a docking protein that plays a role in tyrosine kinase-based signaling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cas scaffolding protein family member 4

Protein Size: 349

Purification: Affinity Purified

• Artikelnummer: AVIARP57390_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57390_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57091
• Wirt: Rabbit