CAT Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAT

Key Reference: Holt,M., (2006) J. Biol. Chem. 281 (25), 17076-17083

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Catalase

Protein Size: 527

Purification: Affinity Purified

• Artikelnummer: AVIARP58437_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58437_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 847
• Wirt: Rabbit