CATIP Antibody - C-terminal region : HRP

CATIP Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55902_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf62

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ciliogenesis-associated TTC17-interacting protein

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55902_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55902_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 375307
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×