CBX2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CBX2 Contains 1 A.T hook DNA-binding domain and 1 chromo domain. CBX2 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CBX2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Chromobox protein homolog 2

Protein Size: 532

Purification: Affinity Purified

• Artikelnummer: AVIARP58370_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58370_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84733
• Wirt: Rabbit
• Konjugat: Conjugated, HRP