CCDC190 Antibody - N-terminal region : FITC

CCDC190 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55775_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf110

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 190

Protein Size: 302

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55775_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55775_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 339512
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×