CCDC54 Antibody - N-terminal region : Biotin

CCDC54 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58605_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of CCDC54 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC54

Key Reference: Dadabayev,A.R., (2005) Am. J. Hematol. 80 (1), 6-11

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 54

Protein Size: 328

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58605_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58605_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 84692
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×