English
CCDC54 Antibody - N-terminal region : FITC
CCDC54 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58605_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The specific function of CCDC54 is not yet known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC54
Key Reference: Dadabayev,A.R., (2005) Am. J. Hematol. 80 (1), 6-11
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Coiled-coil domain-containing protein 54
Protein Size: 328
Purification: Affinity Purified
Description of Target: The specific function of CCDC54 is not yet known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC54
Key Reference: Dadabayev,A.R., (2005) Am. J. Hematol. 80 (1), 6-11
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Coiled-coil domain-containing protein 54
Protein Size: 328
Purification: Affinity Purified
| Artikelnummer | AVIARP58605_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58605_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 84692 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
