CCDC69 Antibody - middle region : FITC

CCDC69 Antibody - middle region : FITC
Artikelnummer
AVIARP55307_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of CCDC69 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 69

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55307_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55307_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26112
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×