CCDC74A Antibody - middle region : FITC

CCDC74A Antibody - middle region : FITC
Artikelnummer
AVIARP58438_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of CCDC74A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC74A

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 74A

Protein Size: 378

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58438_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58438_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 90557
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×