CCNDBP1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-D1-binding protein 1

Protein Size: 360

Purification: Affinity Purified

• Artikelnummer: AVIARP55414_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55414_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23582
• Wirt: Rabbit