CCR2 Antibody - middle region : Biotin

CCR2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58409_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR2

Key Reference: Hendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: C-C chemokine receptor type 2

Protein Size: 374

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58409_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58409_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1231
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×