CCSER1 Antibody - middle region : Biotin

CCSER1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56007_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CCSE1

Key Reference: N/A

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: CLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine-rich coiled-coil domain-containing protein 1

Protein Size: 677

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP56007_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56007_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 401145
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×