Cd247 Antibody - C-terminal region : Biotin

Cd247 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59100_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Cd247 is a component of T cell receptor (TCR) complex that plays a role in TCR assembly and signaling; It does not promote surface expression of Fc gamma RIII, unlike human homolog.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cd247

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 137

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59100_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59100_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25300
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×