CD27 Antibody - C-terminal region : Biotin

CD27 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59093_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD27

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CD27 antigen

Protein Size: 260

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59093_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59093_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 939
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×