CD28 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD28

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell-specific surface glycoprotein CD28

Protein Size: 220

Purification: Affinity Purified

• Artikelnummer: AVIARP59096_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59096_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 940
• Wirt: Rabbit
• Konjugat: Conjugated, FITC