CD28 Antibody - C-terminal region : HRP

CD28 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP59096_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD28

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell-specific surface glycoprotein CD28

Protein Size: 220

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59096_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59096_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 940
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×