CD3E Antibody - middle region : Biotin

CD3E Antibody - middle region : Biotin
Artikelnummer
AVIARP59097_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD3E

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell surface glycoprotein CD3 epsilon chain

Protein Size: 207

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59097_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59097_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 916
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×