English
CD5 Antibody - N-terminal region : FITC
CD5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58440_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD5
Key Reference: Siderovski,D.P., (2008) J. Mol. Biol. 378 (1), 129-144
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: T-cell surface glycoprotein CD5
Protein Size: 495
Purification: Affinity Purified
Description of Target: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD5
Key Reference: Siderovski,D.P., (2008) J. Mol. Biol. 378 (1), 129-144
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: T-cell surface glycoprotein CD5
Protein Size: 495
Purification: Affinity Purified
| Artikelnummer | AVIARP58440_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58440_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 921 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
