CD8A Antibody - middle region : Biotin

CD8A Antibody - middle region : Biotin
Artikelnummer
AVIARP59113_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD8A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell surface glycoprotein CD8 alpha chain

Protein Size: 235

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59113_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59113_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 925
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×