Cdk5rap1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 586

Purification: Affinity Purified

Subunit: -associated protein 1

• Artikelnummer: AVIARP56907_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56907_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 252827
• Wirt: Rabbit