Cela3b Antibody - middle region : HRP

Cela3b Antibody - middle region : HRP
Artikelnummer
AVIARP54812_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cela3b

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Elastase 3B, pancreatic (Predicted), isoform CRA_b EMBL EDL80838.1

Protein Size: 269

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54812_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54812_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 298567
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×