English
CENPI Antibody - N-terminal region : FITC
CENPI Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54805_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
Key Reference: Izuta,H., (2006) Genes Cells 11 (6), 673-684
Molecular Weight: 87kDa
Peptide Sequence: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Centromere protein I
Protein Size: 756
Purification: Affinity Purified
Description of Target: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
Key Reference: Izuta,H., (2006) Genes Cells 11 (6), 673-684
Molecular Weight: 87kDa
Peptide Sequence: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Centromere protein I
Protein Size: 756
Purification: Affinity Purified
| Artikelnummer | AVIARP54805_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54805_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Immunofluorescence, Western Blotting |
| Human Gene ID | 2491 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
