CENPN Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENPN

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 353

Purification: Affinity Purified

• Artikelnummer: AVIARP57258_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57258_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Immunofluorescence, Western Blotting
• Human Gene ID: 55839
• Wirt: Rabbit