CEP70 Antibody - N-terminal region : FITC

CEP70 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58607_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CEP70 plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP70

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centrosomal protein of 70 kDa

Protein Size: 212

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58607_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58607_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 80321
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×