CHMP1B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Charged multivesicular body protein 1b

Protein Size: 199

Purification: Affinity Purified

• Artikelnummer: AVIARP57408_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57408_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57132
• Wirt: Rabbit