CHMP4C antibody

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

Calculated MW: 26

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

• Artikelnummer: GTX04627-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04627-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 66371
• Wirt: Rabbit
• Konjugat: Unconjugated