COX18 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COX18

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial inner membrane protein COX18

Protein Size: 333

Purification: Affinity Purified

• Artikelnummer: AVIARP55715_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55715_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 285521
• Wirt: Rabbit