COX18 Antibody - middle region : FITC

COX18 Antibody - middle region : FITC
Artikelnummer
AVIARP55715_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COX18

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial inner membrane protein COX18

Protein Size: 333

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55715_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55715_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285521
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×