Cpa5 Antibody - N-terminal region : HRP

Cpa5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58705_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cpa5 may have carboxypeptidase activity.

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: PGLSPVDRRTLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribonuclease P protein subunit p21

Protein Size: 436

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58705_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58705_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 408212
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×