Cpne7 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of Cpne7 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copine VII (Predicted), isoform CRA_b EMBL EDL92784.1

Protein Size: 486

Purification: Affinity Purified

• Artikelnummer: AVIARP55052_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55052_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 361433
• Wirt: Rabbit