CRBN Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN

Key Reference: 0

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein cereblon

Protein Size: 442

Purification: Affinity Purified

• Artikelnummer: AVIARP56882_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56882_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51185
• Wirt: Rabbit