CRYL1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRYL1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lambda-crystallin homolog

Protein Size: 319

Purification: Affinity Purified

• Artikelnummer: AVIARP58609_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58609_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51084
• Wirt: Rabbit
• Konjugat: Conjugated, FITC