CST1 Antibody - Middle region : Biotin

CST1 Antibody - Middle region : Biotin
Artikelnummer
AVIARP59199_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.

Immunogen: The immunogen for Anti-CST1 antibody is: synthetic peptide directed towards the Middle region of Human CYTN

Key Reference: N/A

Molecular Weight: 15 kDa

Peptide Sequence: Synthetic peptide located within the following region: AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 141

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP59199_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59199_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1469
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×