CST11 Antibody - N-terminal region : FITC

CST11 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58448_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CST11 has antibacterial activity against the Gram-negative bacteria E.coli. It may play a role in sperm maturation and fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST11

Key Reference: N/A

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-11

Protein Size: 138

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58448_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58448_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 140880
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×