English
CST11 Antibody - N-terminal region : FITC
CST11 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58448_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: CST11 has antibacterial activity against the Gram-negative bacteria E.coli. It may play a role in sperm maturation and fertilization.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST11
Key Reference: N/A
Molecular Weight: 15kDa
Peptide Sequence: Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cystatin-11
Protein Size: 138
Purification: Affinity purified
Description of Target: CST11 has antibacterial activity against the Gram-negative bacteria E.coli. It may play a role in sperm maturation and fertilization.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST11
Key Reference: N/A
Molecular Weight: 15kDa
Peptide Sequence: Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cystatin-11
Protein Size: 138
Purification: Affinity purified
| Artikelnummer | AVIARP58448_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58448_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 140880 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
