CST8 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CST8

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-8

Protein Size: 142

Purification: Affinity Purified

• Artikelnummer: AVIARP59191_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59191_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10047
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin