Cxxc5 Antibody - N-terminal region : FITC

Cxxc5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58792_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cxxc5

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CXXC-type zinc finger protein 5

Protein Size: 317

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58792_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58792_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67393
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×